🧬 PRISM Protein Cage Designer

RFdiffusion2 backbone → LigandMPNN homo-oligomeric sequence → BindCraft interface optimisation

🔁 Design pipeline
  1. RFdiffusion2 — SE(3) flow matching generates 200-residue subunit backbones
  2. PRISM symmetry engine — 12-subunit T-cage at 50 Å radius
  3. LigandMPNN — homo-oligomeric sequence design (identical chains)
  4. BindCraft — AF2-hallucination glue-binder optimisation at A–C interface
📊 Run summary
Cage designs4
Subunits / cage12 (T symmetry)
Residues / subunit200
Glue binders generated11 (Design 0)
Relaxed binders3
Best ΔG−44.6 REU

🏗 Cage Assemblies

Design 0 — T‑cage

✅ 11 glue binders
Cage geometry
Cavity ø6.7 nm
Rg52.6 Å
Shell33.4–69.6 Å
Close interfaces6
Clashes (2 Å)0
LigandMPNN sequence
Confidence0.439
Seq recovery0.305
Interface res16
Chain A sequence (200 res):
VEREIRRAMERCLPDLLKAEVVVVILNGVDLDTQGEAFDILTRELVRAIREAKAANPDRKIHVLIAVSAALTCVRALREYGGRGGVERAAAKAAEVAAKMAAAFEAVGATTRTVVLTAATQAAVDYAEANPDASLDDILAVANAAAAGEIAAEAAAIIRA…

🧲 Glue Binder Analysis — Design 0 (A–C Interface)

Interface targeting: Hotspot residues 72–89, 124, 127 on the A–C subunit interface (contact distance <2.1 Å). BindCraft ran AF2 hallucination to design a peptide that bridges two adjacent cage subunits. iPTM < 0.5 indicates early-stage designs — these are initial trajectories; ΔG and shape complementarity are the primary quality filters.
Viewer shows the full 12-subunit cage (muted, rainbow chains A–L) with the designed glue binder ( gold chain M) docked at the A–C interface.
🟡 Relaxed   ⚪ LowConfidence  ·  Label = binder length

l78_s706912

Relaxed
AF2 prediction quality
pLDDT0.83
iPTM0.15
Rosetta interface energy
ΔG (REU)-25.3
dSASA (Ų)712
Shape compl.0.70
Structure
Length (res)78
Interface res9
Target RMSD2.66
Binder sequence:
GTHTIEWEAFGMTLTYTFEPDEAGVMMVTMTVGETTLFTIAWQVYRAMMQFLMDTFPGWREFFGPHMPEMDAVHDDMM